Lineage for d1puc__ (1puc -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332728Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 332729Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 332730Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 332748Protein suc1 [55639] (1 species)
  7. 332749Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)
    in hexamer, the beta-sheets of three dimers form a barrel, closed: n=12, S=12
  8. 332750Domain d1puc__: 1puc - [40675]
    complexed with cps

Details for d1puc__

PDB Entry: 1puc (more details), 1.95 Å

PDB Description: p13suc1 in a strand-exchanged dimer

SCOP Domain Sequences for d1puc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puc__ d.97.1.1 (-) suc1 {Fission yeast (Schizosaccharomyces pombe)}
sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
tlrilqeeewrglgitqslgwemyevhvpephillfkrekd

SCOP Domain Coordinates for d1puc__:

Click to download the PDB-style file with coordinates for d1puc__.
(The format of our PDB-style files is described here.)

Timeline for d1puc__: