Lineage for d1puc__ (1puc -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) 
Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) Protein suc1 [55639] (1 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries) 
Domain d1puc__: 1puc - [40675]
Details for d1puc__
PDB Entry: 1puc (more details), 1.95 Å
PDB Description: p13suc1 in a strand-exchanged dimer
SCOP Domain Sequences for d1puc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puc__ d.97.1.1 (-) suc1 {Fission yeast (Schizosaccharomyces pombe)}
sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
tlrilqeeewrglgitqslgwemyevhvpephillfkrekd
SCOP Domain Coordinates for d1puc__:
Click to download the PDB-style file with coordinates for d1puc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1puc__:
- d1puc__ first appeared (with stable ids) in SCOP 1.55
- d1puc__ appears in SCOP 1.59
- d1puc__ appears in SCOP 1.63
- d1puc__ appears in the current release, SCOPe 2.08, called d1puca_
View in 3D