Lineage for d1ibaa1 (1iba A:15-91)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207154Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2207155Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 2207156Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 2207157Protein Glucose permease domain IIB [55606] (1 species)
  7. 2207158Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
    there are differences in secondary structure packing between the two NMR-determined structures
  8. 2207164Domain d1ibaa1: 1iba A:15-91 [40567]
    Other proteins in same PDB: d1ibaa2

Details for d1ibaa1

PDB Entry: 1iba (more details)

PDB Description: glucose permease (domain iib), nmr, 11 structures
PDB Compounds: (A:) glucose permease

SCOPe Domain Sequences for d1ibaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibaa1 d.95.1.1 (A:15-91) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
tksdnlktemdeyirnf

SCOPe Domain Coordinates for d1ibaa1:

Click to download the PDB-style file with coordinates for d1ibaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ibaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ibaa2