![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) ![]() |
![]() | Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein) |
![]() | Protein Glucose permease domain IIB [55606] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55607] (4 PDB entries) there are differences in secondary structure packing between the two NMR-determined structures |
![]() | Domain d1ibaa_: 1iba A: [40567] |
PDB Entry: 1iba (more details)
SCOPe Domain Sequences for d1ibaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibaa_ d.95.1.1 (A:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]} mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg tksdnlktemdeyirnfg
Timeline for d1ibaa_: