Lineage for d1ibaa_ (1iba A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662475Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1662476Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 1662477Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 1662478Protein Glucose permease domain IIB [55606] (1 species)
  7. 1662479Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
    there are differences in secondary structure packing between the two NMR-determined structures
  8. 1662485Domain d1ibaa_: 1iba A: [40567]

Details for d1ibaa_

PDB Entry: 1iba (more details)

PDB Description: glucose permease (domain iib), nmr, 11 structures
PDB Compounds: (A:) glucose permease

SCOPe Domain Sequences for d1ibaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibaa_ d.95.1.1 (A:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
tksdnlktemdeyirnfg

SCOPe Domain Coordinates for d1ibaa_:

Click to download the PDB-style file with coordinates for d1ibaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ibaa_: