Lineage for d1iba__ (1iba -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34734Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
  4. 34735Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 34736Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 34737Protein Glucose permease domain IIB [55606] (1 species)
  7. 34738Species Escherichia coli [TaxId:562] [55607] (1 PDB entry)
  8. 34739Domain d1iba__: 1iba - [40567]

Details for d1iba__

PDB Entry: 1iba (more details)

PDB Description: glucose permease (domain iib), nmr, 11 structures

SCOP Domain Sequences for d1iba__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iba__ d.95.1.1 (-) Glucose permease domain IIB {Escherichia coli}
mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
tksdnlktemdeyirnfg

SCOP Domain Coordinates for d1iba__:

Click to download the PDB-style file with coordinates for d1iba__.
(The format of our PDB-style files is described here.)

Timeline for d1iba__: