SCOPe 2.08: Domain d1ibaa1: 1iba A:15-91

Lineage for d1ibaa1 (1iba A:15-91)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family)

5. Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)

6. Protein Glucose permease domain IIB [55606] (1 species)

7. Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
   there are differences in secondary structure packing between the two NMR-determined structures

8. Domain d1ibaa1: 1iba A:15-91 [40567]
   Other proteins in same PDB: d1ibaa2

Details for d1ibaa1

PDB Entry: 1iba

PDB Description: glucose permease (domain iib), nmr, 11 structures

PDB Compounds: (A:) glucose permease

SCOPe Domain Sequences for d1ibaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ibaa1 d.95.1.1 (A:15-91) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
tksdnlktemdeyirnf

Timeline for d1ibaa1:

• d1ibaa1 first appeared (with stable ids) in SCOP 1.55, called d1iba__
  
• d1ibaa1 appears in SCOPe 2.07