PDB entry 1iba

View 1iba on RCSB PDB site
Description: glucose permease (domain iib), nmr, 11 structures
Class: phosphotransferase
Keywords: phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane, inner membrane, phosphotransferase
Deposited on 1996-03-23, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose permease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ibaa1, d1ibaa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ibaA (A:)
    mfknedakatgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaa
    gvvvagsgvqaifgtksdnlktemdeyirnfgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ibaA (A:)
    mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
    tksdnlktemdeyirnfg