Lineage for d1cm3a_ (1cm3 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Escherichia coli [TaxId:562] [55599] (11 PDB entries) 
Domain d1cm3a_: 1cm3 A: [40557]
Details for d1cm3a_
PDB Entry: 1cm3 (more details), 1.6 Å
PDB Description: his15asp hpr from e. coli
SCOP Domain Sequences for d1cm3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cm3a_ d.94.1.1 (A:) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapngldtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele
SCOP Domain Coordinates for d1cm3a_:
Click to download the PDB-style file with coordinates for d1cm3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cm3a_:
- d1cm3a_ appears in SCOP 1.57
- d1cm3a_ appears in the current release, SCOPe 2.08
View in 3D