PDB entry 1cm3

View 1cm3 on RCSB PDB site
Description: his15asp hpr from e. coli
Deposited on 1999-05-13, released 2000-05-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-17, with a file datestamp of 2000-05-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cm3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cm3A (A:)
mfqqevtitapngldtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele