Lineage for d1poh__ (1poh -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34701Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 34702Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 34703Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 34704Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 34716Species Escherichia coli [TaxId:562] [55599] (11 PDB entries)
  8. 34720Domain d1poh__: 1poh - [40553]

Details for d1poh__

PDB Entry: 1poh (more details), 2 Å

PDB Description: the 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination

SCOP Domain Sequences for d1poh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poh__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d1poh__:

Click to download the PDB-style file with coordinates for d1poh__.
(The format of our PDB-style files is described here.)

Timeline for d1poh__: