Lineage for d1poh__ (1poh -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Escherichia coli [TaxId:562] [55599] (11 PDB entries) 
Domain d1poh__: 1poh - [40553]
Details for d1poh__
PDB Entry: 1poh (more details), 2 Å
PDB Description: the 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination
SCOP Domain Sequences for d1poh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poh__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele
SCOP Domain Coordinates for d1poh__:
Click to download the PDB-style file with coordinates for d1poh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1poh__:
- d1poh__ first appeared (with stable ids) in SCOP 1.55
- d1poh__ appears in SCOP 1.59
- d1poh__ appears in the current release, SCOPe 2.08, called d1poha_
View in 3D