SCOPe 2.02: Domain d2shpa2: 2shp A:2-110

Lineage for d2shpa2 (2shp A:2-110)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Tyrosine phoshatase shp-2 [55589] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry)

8. Domain d2shpa2: 2shp A:2-110 [40533]
   Other proteins in same PDB: d2shpa1, d2shpb1
   complexed with cat

Details for d2shpa2

PDB Entry: 2shp, 2 Å

PDB Description: tyrosine phosphatase shp-2

PDB Compounds: (A:) shp-2

SCOPe Domain Sequences for d2shpa2:

Sequence; same for both SEQRES and ATOM records:

>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]}
ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Timeline for d2shpa2:

• d2shpa2 first appeared (with stable ids) in SCOP 1.55
  
• d2shpa2 appears in SCOPe 2.01
  
• d2shpa2 appears in SCOPe 2.03
  
• d2shpa2 appears in the current release, SCOPe 2.08