| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Tyrosine phoshatase shp-2 [55589] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry) |
| Domain d2shpa2: 2shp A:2-110 [40533] Other proteins in same PDB: d2shpa1, d2shpb1 complexed with cat |
PDB Entry: 2shp (more details), 2 Å
SCOPe Domain Sequences for d2shpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]}
ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
Timeline for d2shpa2: