Lineage for d2shpa2 (2shp A:2-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965646Protein Tyrosine phoshatase shp-2 [55589] (1 species)
  7. 2965647Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry)
  8. 2965648Domain d2shpa2: 2shp A:2-110 [40533]
    Other proteins in same PDB: d2shpa1, d2shpb1
    complexed with cat

Details for d2shpa2

PDB Entry: 2shp (more details), 2 Å

PDB Description: tyrosine phosphatase shp-2
PDB Compounds: (A:) shp-2

SCOPe Domain Sequences for d2shpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]}
ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

SCOPe Domain Coordinates for d2shpa2:

Click to download the PDB-style file with coordinates for d2shpa2.
(The format of our PDB-style files is described here.)

Timeline for d2shpa2: