Lineage for d2shpb1 (2shp B:219-525)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116409Protein Tyrosine phosphatase [52806] (7 species)
  7. 2116548Species Human (Homo sapiens), shp-2 [TaxId:9606] [52810] (1 PDB entry)
  8. 2116550Domain d2shpb1: 2shp B:219-525 [32684]
    Other proteins in same PDB: d2shpa2, d2shpa3, d2shpb2, d2shpb3
    contains tandem repeat of two SH2 domains in the N-terminal region
    complexed with cat

Details for d2shpb1

PDB Entry: 2shp (more details), 2 Å

PDB Description: tyrosine phosphatase shp-2
PDB Compounds: (B:) shp-2

SCOPe Domain Sequences for d2shpb1:

Sequence, based on SEQRES records: (download)

>d2shpb1 c.45.1.2 (B:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrsiymav
qhyietl

Sequence, based on observed residues (ATOM records): (download)

>d2shpb1 c.45.1.2 (B:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]}
trinaaeiesrvrelskgfweefetlqqqeckllysrkegqrqenknknryknilpfdht
rvvlhdsdyinaniimpkksyiatqgclqntvndfwrmvfqensrvivmttkevergksk
cvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpdh
gvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvdc
didvpktiqmvrsqrsgmvqteaqyrsiymavqhyietl

SCOPe Domain Coordinates for d2shpb1:

Click to download the PDB-style file with coordinates for d2shpb1.
(The format of our PDB-style files is described here.)

Timeline for d2shpb1: