Lineage for d2shpb2 (2shp B:2-110)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1212958Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1212959Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1212960Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1213301Protein Tyrosine phoshatase shp-2 [55589] (1 species)
  7. 1213302Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry)
  8. 1213305Domain d2shpb2: 2shp B:2-110 [40535]
    Other proteins in same PDB: d2shpa1, d2shpb1
    complexed with cat

Details for d2shpb2

PDB Entry: 2shp (more details), 2 Å

PDB Description: tyrosine phosphatase shp-2
PDB Compounds: (B:) shp-2

SCOPe Domain Sequences for d2shpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2shpb2 d.93.1.1 (B:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]}
ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

SCOPe Domain Coordinates for d2shpb2:

Click to download the PDB-style file with coordinates for d2shpb2.
(The format of our PDB-style files is described here.)

Timeline for d2shpb2: