Lineage for d2shpa2 (2shp A:2-110)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34674Protein Tyrosine phoshatase shp-2 [55589] (1 species)
  7. 34675Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry)
  8. 34676Domain d2shpa2: 2shp A:2-110 [40533]
    Other proteins in same PDB: d2shpa1, d2shpb1

Details for d2shpa2

PDB Entry: 2shp (more details), 2 Å

PDB Description: tyrosine phosphatase shp-2

SCOP Domain Sequences for d2shpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens)}
ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd
yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

SCOP Domain Coordinates for d2shpa2:

Click to download the PDB-style file with coordinates for d2shpa2.
(The format of our PDB-style files is described here.)

Timeline for d2shpa2: