Lineage for d7dlxd1 (7dlx D:38-128)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2699079Species Saccharomyces cerevisiae [TaxId:285006] [404975] (1 PDB entry)
  8. 2699086Domain d7dlxd1: 7dlx D:38-128 [405015]
    automated match to d2jssa2

Details for d7dlxd1

PDB Entry: 7dlx (more details), 2.4 Å

PDB Description: crystal structure of h2am4>z-h2b
PDB Compounds: (D:) Histone H2B,Histone H2A

SCOPe Domain Sequences for d7dlxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dlxd1 a.22.1.1 (D:38-128) automated matches {Saccharomyces cerevisiae [TaxId: 285006]}
etyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisarei
qtavrlilpgelakhavsegtravtkyssst

SCOPe Domain Coordinates for d7dlxd1:

Click to download the PDB-style file with coordinates for d7dlxd1.
(The format of our PDB-style files is described here.)

Timeline for d7dlxd1: