| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:285006] [404975] (1 PDB entry) |
| Domain d7dlxd1: 7dlx D:38-128 [405015] automated match to d2jssa2 |
PDB Entry: 7dlx (more details), 2.4 Å
SCOPe Domain Sequences for d7dlxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dlxd1 a.22.1.1 (D:38-128) automated matches {Saccharomyces cerevisiae [TaxId: 285006]}
etyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisarei
qtavrlilpgelakhavsegtravtkyssst
Timeline for d7dlxd1: