Lineage for d2jssa2 (2jss A:1-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698262Species Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId:4932] [68985] (2 PDB entries)
  8. 2698265Domain d2jssa2: 2jss A:1-95 [148193]
    Other proteins in same PDB: d2jssa1
    automatically matched to d1id3h_

Details for d2jssa2

PDB Entry: 2jss (more details)

PDB Description: nmr structure of chaperone chz1 complexed with histone h2a.z-h2b
PDB Compounds: (A:) Chimera of Histone H2B.1 and Histone H2A.Z

SCOPe Domain Sequences for d2jssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jssa2 a.22.1.1 (A:1-95) Histone H2B {Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId: 4932]}
rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar
eiqtavrlilpgelakhavsegtravtkyssstqa

SCOPe Domain Coordinates for d2jssa2:

Click to download the PDB-style file with coordinates for d2jssa2.
(The format of our PDB-style files is described here.)

Timeline for d2jssa2:

2698265
d2jssa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2jssa1