Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (6 species) |
Species Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId:4932] [68985] (2 PDB entries) |
Domain d2jssa2: 2jss A:1-95 [148193] Other proteins in same PDB: d2jssa1 automatically matched to d1id3h_ |
PDB Entry: 2jss (more details)
SCOPe Domain Sequences for d2jssa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jssa2 a.22.1.1 (A:1-95) Histone H2B {Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId: 4932]} rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar eiqtavrlilpgelakhavsegtravtkyssstqa
Timeline for d2jssa2: