![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
![]() | Family c.52.1.34: PA N-terminal domain [254166] (3 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
![]() | Protein PA N-terminal domain [254375] (8 species) |
![]() | Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries) |
![]() | Domain d6wj4a1: 6wj4 A:1-195 [403936] Other proteins in same PDB: d6wj4a2 automated match to d4e5ed_ complexed with mn, qq4, so4, u3a |
PDB Entry: 6wj4 (more details), 2.55 Å
SCOPe Domain Sequences for d6wj4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wj4a1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]} medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse
Timeline for d6wj4a1: