SCOPe 2.08: Domain d6uveb_: 6uve B:

Lineage for d6uveb_ (6uve B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d6uveb_: 6uve B: [403895]
   Other proteins in same PDB: d6uvea2
   automated match to d4z9vb_
   complexed with edo, qhv

Details for d6uveb_

PDB Entry: 6uve, 2.87 Å

PDB Description: crystal structure of bcl-xl bound to compound 7: (r)-3-(benzylthio)-2- (3-(4-chloro-[1,1':2',1'':3'',1'''-quaterphenyl]-4'''-carbonyl)-3-(4- methylbenzyl)ureido)propanoic acid

PDB Compounds: (B:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6uveb_:

Sequence, based on SEQRES records:

>d6uveb_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
snrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpgta
yqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhle
pwiqenggwdtfvelygnnaaa

Sequence, based on observed residues (ATOM records):

>d6uveb_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
snrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafitpgtayqsfeqvv
nelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlepwiqengg
wdtfvelygnnaaa

Timeline for d6uveb_:

• d6uveb_ first appeared in SCOPe 2.07