Lineage for d7d6qf_ (7d6q F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788585Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2788592Species Escherichia coli [TaxId:562] [50211] (17 PDB entries)
  8. 2788627Domain d7d6qf_: 7d6q F: [403217]
    Other proteins in same PDB: d7d6qa_
    automated match to d1r4pb_
    complexed with 1ps

Details for d7d6qf_

PDB Entry: 7d6q (more details), 1.8 Å

PDB Description: crystal structure of the stx2a
PDB Compounds: (F:) Shiga toxin 2 B subunit

SCOPe Domain Sequences for d7d6qf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d6qf_ b.40.2.1 (F:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d7d6qf_:

Click to download the PDB-style file with coordinates for d7d6qf_.
(The format of our PDB-style files is described here.)

Timeline for d7d6qf_: