PDB entry 7d6q

View 7d6q on RCSB PDB site
Description: Crystal structure of the Stx2a
Class: toxin
Keywords: Shiga toxin, TOXIN
Deposited on 2020-10-01, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA N-glycosylase
    Species: Escherichia coli [TaxId:562]
    Gene: STX2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d6qa_
  • Chain 'B':
    Compound: Shiga toxin 2 B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: stxII, stx2B, stx2B_2, stx2dB, stx2vB, stxB2, vtx2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d6qb_
  • Chain 'C':
    Compound: Shiga toxin 2 B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: stxII, stx2B, stx2B_2, stx2dB, stx2vB, stxB2, vtx2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d6qc_
  • Chain 'D':
    Compound: Shiga toxin 2 B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: stxII, stx2B, stx2B_2, stx2dB, stx2vB, stxB2, vtx2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d6qd_
  • Chain 'E':
    Compound: Shiga toxin 2 B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: stxII, stx2B, stx2B_2, stx2dB, stx2vB, stxB2, vtx2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d6qe_
  • Chain 'F':
    Compound: Shiga toxin 2 B subunit
    Species: Escherichia coli [TaxId:562]
    Gene: stxII, stx2B, stx2B_2, stx2dB, stx2vB, stxB2, vtx2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d6qf_
  • Heterogens: 1PS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7d6qA (A:)
    reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
    qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
    aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
    alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
    chhqgarsvravneesqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7d6qA (A:)
    reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
    qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
    aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
    alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
    chqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7d6qB (B:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >7d6qB (B:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcsgfa
    evqfnnd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7d6qC (C:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7d6qD (D:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7d6qE (E:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7d6qF (F:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd