![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Escherichia coli [TaxId:562] [50211] (17 PDB entries) |
![]() | Domain d7d6qe_: 7d6q E: [403207] Other proteins in same PDB: d7d6qa_ automated match to d1r4pb_ complexed with 1ps |
PDB Entry: 7d6q (more details), 1.8 Å
SCOPe Domain Sequences for d7d6qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d6qe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs gfaevqfnnd
Timeline for d7d6qe_: