SCOPe 2.08: Domain d7kylz_: 7kyl Z:

Lineage for d7kylz_ (7kyl Z:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Powassan virus [TaxId:58535] [402170] (1 PDB entry)

8. Domain d7kylz_: 7kyl Z: [402262]
   Other proteins in same PDB: d7kylh_, d7kyll1, d7kyll2, d7kylx_, d7kyly1, d7kyly2
   automated match to d1pjwa_
   complexed with cl, na

Details for d7kylz_

PDB Entry: 7kyl, 2 Å

PDB Description: powassan virus envelope protein diii in complex with neutralizing fab powv-80

PDB Compounds: (Z:) Envelope protein domain III

SCOPe Domain Sequences for d7kylz_:

Sequence; same for both SEQRES and ATOM records:

>d7kylz_ b.1.18.0 (Z:) automated matches {Powassan virus [TaxId: 58535]}
ysmcdktkfkwkrvpvdsghdtvvmevsytgsdkpcripvravahgvptinvamlitpnp
tietsgggfiemqlppgdniiyvgdlsqqwfqk

Timeline for d7kylz_:

• d7kylz_ first appeared in SCOPe 2.07