![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Powassan virus [TaxId:58535] [402170] (1 PDB entry) |
![]() | Domain d7kylz_: 7kyl Z: [402262] Other proteins in same PDB: d7kylh_, d7kyll1, d7kyll2, d7kylx_, d7kyly1, d7kyly2 automated match to d1pjwa_ complexed with cl, na |
PDB Entry: 7kyl (more details), 2 Å
SCOPe Domain Sequences for d7kylz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kylz_ b.1.18.0 (Z:) automated matches {Powassan virus [TaxId: 58535]} ysmcdktkfkwkrvpvdsghdtvvmevsytgsdkpcripvravahgvptinvamlitpnp tietsgggfiemqlppgdniiyvgdlsqqwfqk
Timeline for d7kylz_: