SCOPe 2.08: Domain d7kyly2: 7kyl Y:107-213

Lineage for d7kyly2 (7kyl Y:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d7kyly2: 7kyl Y:107-213 [402241]
Other proteins in same PDB: d7kyle_, d7kylh_, d7kyll1, d7kylx_, d7kyly1, d7kylz_
automated match to d1h3pl2
complexed with cl, na

Details for d7kyly2

PDB Description: powassan virus envelope protein diii in complex with neutralizing fab powv-80

PDB Compounds: (Y:) POWV-80 Fab light chain

SCOPe Domain Sequences for d7kyly2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kyly2 b.1.1.2 (Y:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d7kyly2:

Click to download the PDB-style file with coordinates for d7kyly2.
(The format of our PDB-style files is described here.)

Timeline for d7kyly2: