SCOPe 2.08: Domain d7kyll2: 7kyl L:107-213

Lineage for d7kyll2 (7kyl L:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d7kyll2: 7kyl L:107-213 [402270]
   Other proteins in same PDB: d7kyle_, d7kylh_, d7kyll1, d7kylx_, d7kyly1, d7kylz_
   automated match to d1h3pl2
   complexed with cl, na

Details for d7kyll2

PDB Entry: 7kyl, 2 Å

PDB Description: powassan virus envelope protein diii in complex with neutralizing fab powv-80

PDB Compounds: (L:) POWV-80 Fab light chain

SCOPe Domain Sequences for d7kyll2:

Sequence; same for both SEQRES and ATOM records:

>d7kyll2 b.1.1.2 (L:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d7kyll2:

• d7kyll2 first appeared in SCOPe 2.07