![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [55443] (1 species) rudiment "interface" domain of smaller size; beta(3)-alpha |
![]() | Species Chromatium vinosum [TaxId:1049] [55444] (1 PDB entry) |
![]() | Domain d1fcdb3: 1fcd B:328-401 [40219] Other proteins in same PDB: d1fcda1, d1fcda2, d1fcdb1, d1fcdb2, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2 complexed with fad, hem |
PDB Entry: 1fcd (more details), 2.53 Å
SCOPe Domain Sequences for d1fcdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcdb3 d.87.1.1 (B:328-401) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Chromatium vinosum [TaxId: 1049]} pgtpsylntcysilapaygisvaaiyrpnadgsaiesvpdsggvtpvdapdwvlerevqy ayswynnivhdtfg
Timeline for d1fcdb3: