Lineage for d1fcdd2 (1fcd D:81-174)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
duplication: consists of two cytochrome c type domains
Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species) Species Chromatium vinosum [TaxId:1049] [46684] (1 PDB entry) 
Domain d1fcdd2: 1fcd D:81-174 [15969]
Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3
complexed with fad, hem
Details for d1fcdd2
PDB Entry: 1fcd (more details), 2.53 Å
PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution
PDB Compounds: (D:) flavocytochrome c sulfide dehydrogenase (cytochrome subunit)SCOPe Domain Sequences for d1fcdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcdd2 a.3.1.4 (D:81-174) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Chromatium vinosum [TaxId: 1049]}
akqsfdtaladtgaklhdkycekchveggkpladeedyhilagqwtpylqyamsdfreer
rpmekkmasklrellkaegdagldalfafyasqq
SCOPe Domain Coordinates for d1fcdd2:
Click to download the PDB-style file with coordinates for d1fcdd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fcdd2:
View in 3D
