Lineage for d1fcda1 (1fcd A:1-114,A:256-327)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458195Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2458277Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [51966] (1 species)
    has a smaller C-terminal alpha+beta domain instead the "interface" domain
  7. 2458278Species Chromatium vinosum [TaxId:1049] [51967] (1 PDB entry)
  8. 2458279Domain d1fcda1: 1fcd A:1-114,A:256-327 [30593]
    Other proteins in same PDB: d1fcda3, d1fcdb3, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2
    complexed with fad, hem

Details for d1fcda1

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution
PDB Compounds: (A:) flavocytochrome c sulfide dehydrogenase (flavin-binding subunit)

SCOPe Domain Sequences for d1fcda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Chromatium vinosum [TaxId: 1049]}
agrkvvvvgggtggataakyikladpsievtliepntdyytcylsneviggdrklesikh
gydglrahgiqvvhdsatgidpdkklvktaggaefgydrcvvapgieliydkieXqragk
iaqiagltndagwcpvdiktfessihkgihvigdasianpmpksgysansqgkvaaaavv
vllkgee

SCOPe Domain Coordinates for d1fcda1:

Click to download the PDB-style file with coordinates for d1fcda1.
(The format of our PDB-style files is described here.)

Timeline for d1fcda1: