Lineage for d1fcdc2 (1fcd C:81-174)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304962Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
    duplication: consists of two cytochrome c type domains
  6. 2304990Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species)
  7. 2304991Species Chromatium vinosum [TaxId:1049] [46684] (1 PDB entry)
  8. 2304993Domain d1fcdc2: 1fcd C:81-174 [15967]
    Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3
    complexed with fad, hem

Details for d1fcdc2

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution
PDB Compounds: (C:) flavocytochrome c sulfide dehydrogenase (cytochrome subunit)

SCOPe Domain Sequences for d1fcdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcdc2 a.3.1.4 (C:81-174) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Chromatium vinosum [TaxId: 1049]}
akqsfdtaladtgaklhdkycekchveggkpladeedyhilagqwtpylqyamsdfreer
rpmekkmasklrellkaegdagldalfafyasqq

SCOPe Domain Coordinates for d1fcdc2:

Click to download the PDB-style file with coordinates for d1fcdc2.
(The format of our PDB-style files is described here.)

Timeline for d1fcdc2: