Lineage for d1ndaa3 (1nda A:358-484)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34140Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 34141Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins)
  6. 34209Protein Trypanothione reductase [55429] (2 species)
  7. 34225Species Trypanosoma cruzi [TaxId:5693] [55431] (3 PDB entries)
  8. 34230Domain d1ndaa3: 1nda A:358-484 [40194]
    Other proteins in same PDB: d1ndaa1, d1ndaa2, d1ndab1, d1ndab2

Details for d1ndaa3

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state

SCOP Domain Sequences for d1ndaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndaa3 d.87.1.1 (A:358-484) Trypanothione reductase {Trypanosoma cruzi}
htrvasavfsippigtcglieevaskryevvavylssftplmhnisgskyktfvakiitn
hsdgtvlgvhllgdnapeiiqgvgiclklnakisdfyntigvhptsaeelcsmrtpsyyy
vkgekme

SCOP Domain Coordinates for d1ndaa3:

Click to download the PDB-style file with coordinates for d1ndaa3.
(The format of our PDB-style files is described here.)

Timeline for d1ndaa3: