SCOP 1.55: Domain d1ndab2: 1nda B:170-286

Lineage for d1ndab2 (1nda B:170-286)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)

6. Protein Trypanothione reductase [51947] (2 species)

7. Species Trypanosoma cruzi [TaxId:5693] [51949] (3 PDB entries)

8. Domain d1ndab2: 1nda B:170-286 [30528]
   Other proteins in same PDB: d1ndaa3, d1ndab3

Details for d1ndab2

PDB Entry: 1nda, 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state

SCOP Domain Sequences for d1ndab2:

Sequence; same for both SEQRES and ATOM records:

>d1ndab2 c.3.1.5 (B:170-286) Trypanothione reductase {Trypanosoma cruzi}
pgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrg
fdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaig

Timeline for d1ndab2:

• d1ndab2 appears in SCOP 1.57
  
• d1ndab2 appears in the current release, SCOPe 2.08