Lineage for d6zdea_ (6zde A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842737Protein Retinal dehydrogenase/reductase 3 [141907] (1 species)
  7. 2842738Species Human (Homo sapiens) [TaxId:9606] [141908] (15 PDB entries)
    Uniprot Q9BPX1 4-253
  8. 2842746Domain d6zdea_: 6zde A: [401537]
    automated match to d1ydea1
    complexed with na, nad, qfz

Details for d6zdea_

PDB Entry: 6zde (more details), 1.87 Å

PDB Description: 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with pentafluorophenol
PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d6zdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zdea_ c.2.1.2 (A:) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}
tryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvt
qeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkl
alpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncisp
gniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiell
vtggaelgygck

SCOPe Domain Coordinates for d6zdea_:

Click to download the PDB-style file with coordinates for d6zdea_.
(The format of our PDB-style files is described here.)

Timeline for d6zdea_: