PDB entry 6zde

View 6zde on RCSB PDB site
Description: 17beta-hydroxysteroid dehydrogenase type 14 variant S205 in complex with pentafluorophenol
Class: oxidoreductase
Keywords: Inhibitor Complex, OXIDOREDUCTASE
Deposited on 2020-06-14, released 2021-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1
      • variant (204)
    Domains in SCOPe 2.08: d6zdea_
  • Heterogens: QFZ, NAD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6zdeA (A:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >6zdeA (A:)
    tryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvt
    qeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkl
    alpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncisp
    gniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiell
    vtggaelgygck