Lineage for d1gavq_ (1gav Q:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
6-standed beta-sheet followed with 2 helices; meanderSuperfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) 
Protein GA coat protein [55409] (1 species) Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries) 
Domain d1gavq_: 1gav Q: [40112]
Details for d1gavq_
PDB Entry: 1gav (more details), 3.4 Å
PDB Description: bacteriophage ga protein capsid
SCOP Domain Sequences for d1gavq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gavq_ d.85.1.1 (Q:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya
SCOP Domain Coordinates for d1gavq_:
Click to download the PDB-style file with coordinates for d1gavq_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gavq_:
- d1gavq_ first appeared (with stable ids) in SCOP 1.55
- d1gavq_ appears in SCOP 1.61
- d1gavq_ appears in SCOP 1.65
- d1gavq_ appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1gav0_, d1gav1_, d1gav2_, d1gav3_, d1gav4_, d1gav5_, d1gav6_, d1gav7_, d1gav8_, d1gav9_, d1gava_, d1gavb_, d1gavc_, d1gavd_, d1gave_, d1gavf_, d1gavg_, d1gavh_, d1gavi_, d1gavj_, d1gavk_, d1gavl_, d1gavm_, d1gavn_, d1gavo_, d1gavp_, d1gavr_, d1gavs_, d1gavt_, d1gavu_, d1gavv_, d1gavw_, d1gavx_, d1gavy_, d1gavz_ |
