| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
| Protein GA coat protein [55409] (1 species) |
| Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries) |
| Domain d1gavb_: 1gav B: [40097] |
PDB Entry: 1gav (more details), 3.4 Å
SCOP Domain Sequences for d1gavb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gavb_ d.85.1.1 (B:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya
Timeline for d1gavb_:
View in 3DDomains from other chains: (mouse over for more information) d1gav0_, d1gav1_, d1gav2_, d1gav3_, d1gav4_, d1gav5_, d1gav6_, d1gav7_, d1gav8_, d1gav9_, d1gava_, d1gavc_, d1gavd_, d1gave_, d1gavf_, d1gavg_, d1gavh_, d1gavi_, d1gavj_, d1gavk_, d1gavl_, d1gavm_, d1gavn_, d1gavo_, d1gavp_, d1gavq_, d1gavr_, d1gavs_, d1gavt_, d1gavu_, d1gavv_, d1gavw_, d1gavx_, d1gavy_, d1gavz_ |