Lineage for d1gavq_ (1gav Q:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34001Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 34002Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 34003Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 34012Protein GA coat protein [55409] (1 species)
  7. 34013Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 34042Domain d1gavq_: 1gav Q: [40112]

Details for d1gavq_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gavq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gavq_ d.85.1.1 (Q:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gavq_:

Click to download the PDB-style file with coordinates for d1gavq_.
(The format of our PDB-style files is described here.)

Timeline for d1gavq_: