SCOPe 2.08: Domain d6w78a1: 6w78 A:27-332

Lineage for d6w78a1 (6w78 A:27-332)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Carrot (Daucus carota) [TaxId:4039] [400848] (1 PDB entry)

8. Domain d6w78a1: 6w78 A:27-332 [400849]
   Other proteins in same PDB: d6w78a2
   automated match to d1ogqa_
   complexed with nag

Details for d6w78a1

PDB Entry: 6w78, 2.31 Å

PDB Description: crystal structure of a plant ice-binding protein

PDB Compounds: (A:) Antifreeze polypeptide

SCOPe Domain Sequences for d6w78a1:

Sequence; same for both SEQRES and ATOM records:

>d6w78a1 c.10.2.0 (A:27-332) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
qrcnnndkqallqiktalknptitdswvsdddccgwdlvecdetsnriisliiqddealt
gqippqvgdlpylqalwfrklpnlfgkipeeisalkdlkslrlsstslsgpvplffpqlt
kltcldlsfnkllgvippqlstlpnlkalhlerneltgeipdifgnfagspdiylshnql
tgfvpktfaradpirldfsgnrlegdisflfgpkkrlemldfsgnvlsfnfsrvqefpps
ltyldlnhnqisgslsselakldlqtfnvsdnnlcgkiptggnlqrfdrtaylhnsclcg
aplpec

Timeline for d6w78a1:

• d6w78a1 first appeared in SCOPe 2.07