Lineage for d1ogqa_ (1ogq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851918Family c.10.2.8: Polygalacturonase inhibiting protein PGIP [89569] (1 protein)
    this is a repeat family; one repeat unit is 1ogq A:110-134 found in domain
  6. 2851919Protein Polygalacturonase inhibiting protein PGIP [89570] (1 species)
  7. 2851920Species French bean (Phaseolus vulgaris) [TaxId:3885] [89571] (1 PDB entry)
  8. 2851921Domain d1ogqa_: 1ogq A: [86996]
    complexed with act, nag

Details for d1ogqa_

PDB Entry: 1ogq (more details), 1.7 Å

PDB Description: the crystal structure of pgip (polygalacturonase inhibiting protein), a leucine rich repeat protein involved in plant defense
PDB Compounds: (A:) polygalacturonase inhibiting protein

SCOPe Domain Sequences for d1ogqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {French bean (Phaseolus vulgaris) [TaxId: 3885]}
elcnpqdkqallqikkdlgnpttlsswlpttdccnrtwlgvlcdtdtqtyrvnnldlsgl
nlpkpypipsslanlpylnflyigginnlvgpippaiakltqlhylyithtnvsgaipdf
lsqiktlvtldfsynalsgtlppsisslpnlvgitfdgnrisgaipdsygsfsklftsmt
isrnrltgkipptfanlnlafvdlsrnmlegdasvlfgsdkntqkihlaknslafdlgkv
glsknlngldlrnnriygtlpqgltqlkflhslnvsfnnlcgeipqggnlqrfdvsayan
nkclcgsplpact

SCOPe Domain Coordinates for d1ogqa_:

Click to download the PDB-style file with coordinates for d1ogqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ogqa_: