Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.8: Polygalacturonase inhibiting protein PGIP [89569] (1 protein) this is a repeat family; one repeat unit is 1ogq A:110-134 found in domain |
Protein Polygalacturonase inhibiting protein PGIP [89570] (1 species) |
Species French bean (Phaseolus vulgaris) [TaxId:3885] [89571] (1 PDB entry) |
Domain d1ogqa_: 1ogq A: [86996] complexed with act, nag |
PDB Entry: 1ogq (more details), 1.7 Å
SCOPe Domain Sequences for d1ogqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {French bean (Phaseolus vulgaris) [TaxId: 3885]} elcnpqdkqallqikkdlgnpttlsswlpttdccnrtwlgvlcdtdtqtyrvnnldlsgl nlpkpypipsslanlpylnflyigginnlvgpippaiakltqlhylyithtnvsgaipdf lsqiktlvtldfsynalsgtlppsisslpnlvgitfdgnrisgaipdsygsfsklftsmt isrnrltgkipptfanlnlafvdlsrnmlegdasvlfgsdkntqkihlaknslafdlgkv glsknlngldlrnnriygtlpqgltqlkflhslnvsfnnlcgeipqggnlqrfdvsayan nkclcgsplpact
Timeline for d1ogqa_: