SCOPe 2.08: Domain d6vmji2: 6vmj I:107-213

Lineage for d6vmji2 (6vmj I:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6vmji2: 6vmj I:107-213 [400669]
   Other proteins in same PDB: d6vmja1, d6vmjb_, d6vmje1, d6vmjf_, d6vmji1, d6vmjj_, d6vmjl1, d6vmjm_, d6vmjw_, d6vmjx_, d6vmjy_, d6vmjz_
   automated match to d1dn0a2
   complexed with cit

Details for d6vmji2

PDB Entry: 6vmj, 2.95 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12

PDB Compounds: (I:) Fab20D12 Light Chain

SCOPe Domain Sequences for d6vmji2:

Sequence; same for both SEQRES and ATOM records:

>d6vmji2 b.1.1.2 (I:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6vmji2:

• d6vmji2 first appeared in SCOPe 2.07