Lineage for d6vmje2 (6vmj E:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751639Domain d6vmje2: 6vmj E:107-213 [400689]
    Other proteins in same PDB: d6vmja1, d6vmjb_, d6vmje1, d6vmjf_, d6vmji1, d6vmjj_, d6vmjl1, d6vmjm_, d6vmjw_, d6vmjx_, d6vmjy_, d6vmjz_
    automated match to d1dn0a2
    complexed with cit

Details for d6vmje2

PDB Entry: 6vmj (more details), 2.95 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12
PDB Compounds: (E:) Fab20D12 Light Chain

SCOPe Domain Sequences for d6vmje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmje2 b.1.1.2 (E:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6vmje2:

Click to download the PDB-style file with coordinates for d6vmje2.
(The format of our PDB-style files is described here.)

Timeline for d6vmje2: