Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Factor D [50563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries) |
Domain d6vmjx_: 6vmj X: [400794] Other proteins in same PDB: d6vmja1, d6vmja2, d6vmjb_, d6vmje1, d6vmje2, d6vmjf_, d6vmji1, d6vmji2, d6vmjj_, d6vmjl1, d6vmjl2, d6vmjm_ automated match to d1bioa_ complexed with cit |
PDB Entry: 6vmj (more details), 2.95 Å
SCOPe Domain Sequences for d6vmjx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vmjx_ b.47.1.2 (X:) Factor D {Human (Homo sapiens) [TaxId: 9606]} ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
Timeline for d6vmjx_: