Lineage for d6vmjx_ (6vmj X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795529Protein Factor D [50563] (1 species)
  7. 2795530Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)
  8. 2795575Domain d6vmjx_: 6vmj X: [400794]
    Other proteins in same PDB: d6vmja1, d6vmja2, d6vmjb_, d6vmje1, d6vmje2, d6vmjf_, d6vmji1, d6vmji2, d6vmjj_, d6vmjl1, d6vmjl2, d6vmjm_
    automated match to d1bioa_
    complexed with cit

Details for d6vmjx_

PDB Entry: 6vmj (more details), 2.95 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12
PDB Compounds: (X:) complement factor d

SCOPe Domain Sequences for d6vmjx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmjx_ b.47.1.2 (X:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d6vmjx_:

Click to download the PDB-style file with coordinates for d6vmjx_.
(The format of our PDB-style files is described here.)

Timeline for d6vmjx_: