SCOPe 2.08: Domain d6vmja1: 6vmj A:1-106

Lineage for d6vmja1 (6vmj A:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6vmja1: 6vmj A:1-106 [400703]
   Other proteins in same PDB: d6vmja2, d6vmje2, d6vmji2, d6vmjl2, d6vmjw_, d6vmjx_, d6vmjy_, d6vmjz_
   automated match to d1dn0a1
   complexed with cit

Details for d6vmja1

PDB Entry: 6vmj, 2.95 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12

PDB Compounds: (A:) Fab20D12 Light Chain

SCOPe Domain Sequences for d6vmja1:

Sequence; same for both SEQRES and ATOM records:

>d6vmja1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitckasqnvdtdvawfqqkpgkapkgliysassrysgvps
rfsgsgsgtdftltisslqpedfatyycqqynnypltfgqgtkvei

Timeline for d6vmja1:

• d6vmja1 first appeared in SCOPe 2.07