Lineage for d6vmjf_ (6vmj F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757986Domain d6vmjf_: 6vmj F: [412025]
    Other proteins in same PDB: d6vmja2, d6vmje2, d6vmji2, d6vmjl2, d6vmjw_, d6vmjx_, d6vmjy_, d6vmjz_
    automated match to d6shgh_
    complexed with cit

Details for d6vmjf_

PDB Entry: 6vmj (more details), 2.95 Å

PDB Description: crystal structure of human complement factor d with anti-factor d fab 20d12
PDB Compounds: (F:) Fab20D12 heavy chain

SCOPe Domain Sequences for d6vmjf_:

Sequence, based on SEQRES records: (download)

>d6vmjf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftsyymywvrqapgqglewigeinptsggtnf
nekfksratltvdtststaylelsslrsedtavyycareggfaywgqgtlvtvssastkg
psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d6vmjf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftsyymywvrqapgqglewigeinptsggtnf
nekfksratltvdtststaylelsslrsedtavyycareggfaywgqgtlvtvssastkg
psvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d6vmjf_:

Click to download the PDB-style file with coordinates for d6vmjf_.
(The format of our PDB-style files is described here.)

Timeline for d6vmjf_:

  • d6vmjf_ is new in SCOPe 2.08-stable