Lineage for d2ms2c_ (2ms2 C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) Protein MS2 virus coat protein [55407] (1 species) Species Bacteriophage MS2 [TaxId:12022] [55408] (21 PDB entries) 
Domain d2ms2c_: 2ms2 C: [40051]
Details for d2ms2c_
PDB Entry: 2ms2 (more details), 2.8 Å
PDB Description: the refined structure of bacteriophage ms2 at 2.8 angstroms resolution
SCOP Domain Sequences for d2ms2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ms2c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
SCOP Domain Coordinates for d2ms2c_:
Click to download the PDB-style file with coordinates for d2ms2c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ms2c_:
- d2ms2c_ appears in SCOP 1.57
- d2ms2c_ appears in the current release, SCOPe 2.08
View in 3D
