| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
| Protein MS2 virus coat protein [55407] (1 species) |
| Species Bacteriophage MS2 [TaxId:12022] [55408] (21 PDB entries) |
| Domain d2ms2b_: 2ms2 B: [40050] |
PDB Entry: 2ms2 (more details), 2.8 Å
SCOP Domain Sequences for d2ms2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ms2b_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d2ms2b_: