Lineage for d6lsna1 (6lsn A:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471550Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries)
  8. 2471553Domain d6lsna1: 6lsn A:1-245 [399727]
    Other proteins in same PDB: d6lsna2, d6lsnb2, d6lsnc2, d6lsnd2, d6lsne_, d6lsnf1, d6lsnf2, d6lsnf3
    automated match to d5fnva1
    complexed with acp, ca, cl, err, gdp, gtp, mes, mg

Details for d6lsna1

PDB Entry: 6lsn (more details), 2.45 Å

PDB Description: crystal structure of tubulin-inhibitor complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6lsna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lsna1 c.32.1.1 (A:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d6lsna1:

Click to download the PDB-style file with coordinates for d6lsna1.
(The format of our PDB-style files is described here.)

Timeline for d6lsna1: