Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Mus musculus [TaxId:10090] [390534] (6 PDB entries) |
Domain d6lsne_: 6lsn E: [399804] Other proteins in same PDB: d6lsna1, d6lsna2, d6lsnb1, d6lsnb2, d6lsnc1, d6lsnc2, d6lsnd1, d6lsnd2, d6lsnf1, d6lsnf2, d6lsnf3 automated match to d4i55e_ complexed with acp, ca, cl, err, gdp, gtp, mes, mg |
PDB Entry: 6lsn (more details), 2.45 Å
SCOPe Domain Sequences for d6lsne_:
Sequence, based on SEQRES records: (download)
>d6lsne_ a.137.10.1 (E:) Stathmin 4 {Mus musculus [TaxId: 10090]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeeas
>d6lsne_ a.137.10.1 (E:) Stathmin 4 {Mus musculus [TaxId: 10090]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eeas
Timeline for d6lsne_: