| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (10 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries) |
| Domain d6lsnc1: 6lsn C:1-245 [399743] Other proteins in same PDB: d6lsna2, d6lsnb2, d6lsnc2, d6lsnd2, d6lsne_, d6lsnf1, d6lsnf2, d6lsnf3 automated match to d5fnva1 complexed with acp, ca, cl, err, gdp, gtp, mes, mg |
PDB Entry: 6lsn (more details), 2.45 Å
SCOPe Domain Sequences for d6lsnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lsnc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d6lsnc1: